Unlimited, fully-verified email leads for one flat subscription price — an offer you’ll find nowhere else on the market!
→ new skymem.com
→ new skymem.com
mail_outline 1 emails found
# |
mail_outline Email
|
calendar_month Date
|
language Domain
|
outbound_outline
|
---|---|---|---|---|
1. | opemilpgdlehklmnidcfaeangkaa.wh@germany.com | 2024-11-23 |
|
outbound_outline |
# |
mail_outline Email
|
---|---|
1 | opemilpgdlehklmnidcfeemjhgaa.wh@germany.com |
2 | opemilpgdlehklmnidcfiecffmaa.wh@germany.com |
3 | opemilpgdlehklmnidcfaeangkaa.wh@germany.com |
News
Unlock unlimited email listings
Yearly subscriptions currently have a 30% discount — available for a limited time.Activate your unlimited access now at: skymem.com/pricing (2025-07-15)
Skymem — Recurring subscriptions for unlimited plans & every payment method!
We’re excited to introduce monthly and annual recurring subscriptions powered by our new payment provider, Lemon Squeezy (Stripe).Enjoy faster plan activation, automatic renewals with no manual payments, and virtually every payment method you could need:
Credit & Debit Cards, Apple Pay, Google Pay, Alipay, WeChat Pay, Cash App Pay, and Bank Debits (ACH).
See plans & pricing
Don’t miss your chance! Activate an unlimited plan, and start leveraging all the new power of Skymem.com. Thank you for your trust—we look forward to your success!(2025-06-29)
Skymem Bulk Data Solution!
Access extensive email leads with our Bulk Data Service
Instant access to millions of email leads
Bulk Data Solution provides you with instant access to millions of verified email leads tailored specifically to your business needs.You can purchase vast quantities of data, from just a few million to hundreds of millions of email records, either as the entire database or customized to your specifications.
(Limited time offer.)
(2025-01-04)
New skymem.com!
We're excited to introduce our enhanced Email Finder tool, designed to make finding accurate email addresses simpler and more efficient.Key features include:
• Email search• Creating email lists
• Generating email verification lists
Most importantly, enjoy unlimited searches, the creation of unlimited email lists, and the ability to generate unlimited verification lists, giving you complete peace of mind.
(2024-09-01)